YouSigma- the web's most extensive resource for information
$6.99 Domain Names at Network Solutions®!
Chapter 60: Rakshasas Wake Kumbhakarna

Go to Home Page

Tell Your Friend About This Website

Download PDF Version

Play Yuddha Kanda Chapter 60 Audio

Rakshasas Wake Kumbhakarna

Summary

Ravana returns to Lanka and asks some demons to go to the abode of sleeping Kumbhakarna, to wake him up and request him to come to him. The slumbering Kumbhakarna is roused by the demons under orders of their king. Kumbhakarna, giant in form, sets out on the high way to see Ravana and the monkeys get alarmed to see the giant demon.

Chapter [Sarga] 60 in Detail

sa pravishya puriim lankaam raamabaanabhayaarditah |

bhagnadarpastadaa raajaa babhuuva vyathitendriyah || 6-60-1

Returning to the City of Lanka, Ravana the King of Demons was afflicted with the fear of Rama's arrows, his pride was humbled and his senses troubled.

maatanga iva simhena garudeneva pannagah |

abhibhuuto.abhavadraajaa raaghavena mahaatmanaa || 6-60-2

The king was overcome by the high-souled Rama, like an elephant is by a lion or a serpent by an eagle.

brahmadandapratiikaanaam vidyuchchalitavarchasaam |

smatan raaghavabaanaanaam vivyathe raaksaseshvarah || 6-60-3

The Lord of Demons was maddened in recollecting Rama's arrows resembling the Rod of Brahma the Lord of creation and possessed of the splendor of lightning.

sa kaajnchanamayam divyamaashritya paramaasanam |

vipreksamaano raksaamsi raavano vaakyamabraviit || 6-60-4

Resting on an excellent and charming throne made of gold; Ravana looked at the demons and spoke the following words:

sarvam tatkhalu me mogham yattaptam paramam tapah |

yatsamaano mahendrena maanusena vinirjitah || 6-60-5

"All that great penance performed by me became a waste indeed, for, I who am equal to Mahendra the Lord of Celestials have been defeated by a mere man!"

idam tadbrahmano ghoram vaakyam maamabhyupasthitam |

maanusebhyo vijaaniihi bhayam tvamiti tattathaa || 6-60-6

"The terrible words of Brahma the Lord of Creation saying, 'You know of the threat from men' appear true. That is so."

devadaanavagandharvairyaksaraaksasapannagaih |

avadhyatvam mayaa praaptam maanusebhyo na yaachitam || 6-60-7

"I sought immunity from death at the hands of celestials, titans or celestials musicians, or semi divine beings or demons or serpent-demons, but f man I made no mention."

viditam maanusam manye raamam dasharathaatmajam |

iksvaakukulajaatena anarnyena yat puraa || 6-60-8

utpatsyati hi madvamshe puruso raaksasaadhama |

yastvaam saputram saamaatyam sabalam saashvasaarathim || 6-60-9

nihanisyati samgraame tvaam kulaadhama durmate |

"Rama the son of Dasaratha is the man I think of whom Anaranya born of Ikshvaku dynasty formerly spoke, saying: 'O, the worst of demons, the worst of your race and the wretched one! In my race will be born a man who will slay you in battle with your sons, ministers, army, horses and charioteer."

shapto.aham vedavatyaa cha yadaa saa dharsitaa puraa || 6-60-10

seyam siitaa mahaabhaagaa jaataa janakanandinii |

"Further, I was formerly cursed by Vedavati when she was humiliated by me. The same Vedavati is born as the highly fortunate Seetha the daughter of Janaka."

umaa nandiishvarashchaapi rambhaa varunakanyakaa || 6-60-11

yathoktaastanmayaa praaptam na midhyaa risibhaasitam |

"What was predicted by Paarvati the consort of Shiva, Nandishvara the attendant of Shiva, Rambha the wife of Nalakubara and Punjikasthala the daughter of Varunda has come to pass! The words of the sages never prove false."

etadevaabhyupaagamya yatnam kartumahaarhatha || 6-60-12

raaksasaashchaapi tisthantu charyaagopuramuurdhasu |

"On account of all this and admitting it, you should exert yourselves to the uttermost. Let the demons go to the summit of Charya Mountain."

sa chaapratimagaambhiiryo devadaanavadarpahaa || 6-60-13

brahmashaapaabhibhuutastu kumbhakarno vibodhyataam |

"Awaken that kumbhakarna, who is without equal in prowess, who humbles the pride of the celestials and demons, and on whom the curse of Brahma the Lord of creation rests."

samare jitamaatmaanam prahastam cha nisuuditam || 6-60-14

jjnaatvaa raksobalam bhiimamaadidesha mahaabalah |

Having known that Prahasta being slain and knowing himself to have been defeated in the battle, Ravana issued his commands tot he dreadful army, saying:

dvaaresu yatnah kriyataam praakaarashchaadhiruhyataam || 6-60-15

nidraavashasamaavistah kumbhakarno vibodhyataam |

"Guard the gates with utmost care. Man the ramparts. Rouse Kumbhakarna who is slumbering soundly."

sukham svapiti nishchintah kaalopahatachetanah || 6-60-16

nava sapta dashaastau cha maasaan svapiti raaksasah |

"Kumbhakarna is sleeping happily, his understanding vitiated by lust and free from all anxieties. The demon sleeps for nine, seven, ten or eight months.

mantram kritvaa prasupto.ayamiastu navame.ahani || 6-60-17

tam tu bodhayata ksipram kumbhakarnam mahaabalam |

"Having deliberated with me nine days ago, he has since fallen asleep. Awaken quickly that mighty Kumbhakarna."

sa hi samkhye mahaabaahuh kakudam sarvaraksasaam || 6-60-18

vaanaraan raajaputrau cha ksiprameva hanisyati |

"The mighty armed Kumbhakarna, the foremost of all demons will kill the monkeys and the two princes at once in the battle."

esa ketuh param samkhye mukhye vai sarvaraksasaam || 6-60-19

kumbhakarnah sadaa shete muudho graamyasukhe ratah |

"This Kumbhakarna, the chief among all the demons and a great mark in the battle, being fond of a rustic [rural] comfort, is always sleeping stupidly."

raamenaabhinirastasya samgraame.asmin sudaarune || 6-60-20

bhavisyati na me shokah kumbhakarne vibodhite |

"If Kumbhakarna is awaken, there will be no worry for me, who stand defeated by Rama in this highly terrific battle."

kim karisyaamyaham tena shakratulyabalena hi || 6-60-21

iidrishe vyasane ghore yo na saahyaaya kalpate |

"What is the use of him, who possessing a strength equal to that of Indra the Lord of celestials, cannot help me in such a dreadful catastrophe?"

te tu tadvachanam shrutvaa raaksasendrasya raaksasaah || 6-60-22

jagmuh paramasambhraantaah kumbhakarnaniveshanam |

Hearing those words of Ravana, those demons very briskly went to the abode of Kumbhakarna.

taam pravishya mahaadvaaraam sarvato yojanaayataam || 6-60-23

kumbhakrnaguhaam ramyaam puspagandhapravaahiniim |

kumbhakarnasya nihshvaasaadavadhuutaa mahaabalaah || 6-60-24

pratisthamaanaah kricchhrena yatnaa tpravivishurguhaam |

Entering the beautiful cave of Kumbhakarna, with a large door, having an area of a Yojana on all sides and bearing a floral perfume, the demons of mighty strength, though shaken off by Kumbhakarna's breaths, remained stable forcefully with difficulty and went into the cave.

taam pravishya guhaam ramyaam ratnakaajnchanakuttimaam || 6-60-25

dadrishurnairritavyaaghraah shayaanam bhiimavikramam |

Entering that beautiful cave inlaid with diamonds and gold, those tigers among demons beheld Kumbhakarna, of terrific prowess, who was sleeping.

te tu tam vikritam suptam vikiirnamiva parvatam || 6-60-26

kumbham mahaanidram sametaah pratyabodhayan |

They together tried to awaken Kumbhakarna who was sleeping nastily like a spread-out mountain in a great slumber.

uurdhvalomaajnchitatanum shvasantamiva pannagam || 6-60-27

bhraamayantam vinihshvaasaih shayaanam bhiimavikramam |

bhiimanaasaaputam tam tu paataalavipulaananam || 6-60-28

shayane nyastasarvaangam medorudhiragandhinam |

kaajnchanaangadanaddhaangam medorudhiragandhinam || 6-60-29

dadrishurnairritavyaaghram kumbhakarnamarindamam |

His limbs covered with down which stood on end, breathing like a serpent, as he slept, Kumbhakarna of irresistible valor emitted dreadful snores, his nostrils being horrible, and his mouth a gaping hell. Stretched to his full length on the earth, he gave forth an odor of marrow and blood, his limbs were adorned with golden armlets and he wore a diadem as bright as the sun, thus did that lion among demons, Kumbhakarna, the slayer of his foes, appear!

tatashcakrurmahaatmaanah kumbhakarnasya chaagraatah || 6-60-30

bhuutaanaam merusamkaasham raashim paramatarpanam |

Then, those powerful demons, in order to satisfy him, placed a heap of venison as high as Mount Meru, in front of Kumbhakarna.

mrigaanaam mahisaanaam cha varaahaanaam cha samchayaan || 6-60-31

chakrurnairritashaarduulaa raashimannasya chaadbhutam |

Those excellent demons piled up a great mass of wonderful food with the meat of deers, buffaloes and pigs.

tatah shonitakumbhaamshcha maamsaani vividhaani cha || 6-60-32

purastaatkumbhakarnasya chakrustridashashatravah |

Then, the demons placed pots of blood and various kinds of meat in front of Kumbhakarna.

lilipushcha paraardhyena chandanena paramtapam || 6-60-33

divyairaashvaasayaamaasurmaalyairgandhaishcha gandhibhih |

They rubbed Kumbhakarna the scourge of his foes with the most rare sandalwood and refreshed him with celestial and fragrant garlands as well as sweet-smelling perfumes.

dhuupagandhaamshcha sasrijustustuvushcha paramtapam || 6-60-34

jaladaa iva chaaneduryaatudhaanaastatastatah |

They burnt incenses and hymned the praises of that warrior who proved fatal to his foes. They cried out noises which burst forth on every side like thunder.

shankhaamshcha puurayaamaasuh shashaankasadrishaprabhaan || 6-60-35

tumulam yugapachchaapi vinedushchaapyamarsitaah |

They blew couches which were as bright as the moon and with impatience, made with impatience, made sounds tumultuously all at once.

neduraasphotayaamaasushciksipuste nishaacharaah || 6-60-36

kumbhakarnavibodhaartham chakrustevipulam svanam |

Those demons made sounds by clapping their hands, in order to awaken Kumbhakarna and shook him too, creating a great clamor.

sashankhabheriipanavapranaada |

maasphotitaksvelitasimhanaadam |

disho dravantastridivam kirantah |

shrutvaa vihamgaah sahasaa nipetuh || 6-60-37

The birds passing through the sky ran helter-shelter and fell down soon on hearing the sounds of the couches, drums, gongs, clapping of hands and leonine roars.

yadaa bhrisham tairninadairmahaatmaa |

na kambhakarno bubudhe prasuptah |

tato bhushundiirmusalaani sarve |

raksoganaastam jagrihurgadaashcha || 6-60-38

As the illustrious Kumbhakarna did not waken from his slumber despite those great sounds, all troops of demons seized hold of bars, pestles and maces towards him.

tam shailashringermusalairgadaabhi |

rvaksahsthale mudgaramustibhishcha |

sukhaprasuptam bhuvi kumbhakarnam |

raksaamsyudagraani tadaa nijaghnah || 6-60-39

Then, the cruel demons struck that sleeping Kumbhakarna on his chest with mountain-tops, pestles, maces, hammers and their fists.

tasya nihshvaasavaatena kumbhakarnasya raksasah |

raaksasaa balavanto.api sthaatum shekurna chaagratah || 6-60-40

Even with all their strength, the demons could not stand upright before the breathing winds of Kumbhakarna, the demon.

tatah parihitaa gaadham raaksasaa bhiimavikramaah |

mridangapanavaan bheriih shankhakumbhaganaamstathaa || 6-60-41

Then, the terribly strong demons firmly seated themselves round him and began to beat drums, cymbals, kettle-drums and myriads of couches and trumpets.

dasha raaksasasaahasram yugapatparyavaarayat |

niilajnjanachayaakaaram te tu tam pratybodhayan || 6-60-42

abhighnanto nadantashcha na cha sambubudhe tadaa |

Ten thousand demons surrounded him all at once. Beating that colossus who resembled a heap of antimony, the demons on their part tried to rouse him by making sounds. Even then, he did not wake.

yadaa chainam na shekuste pratibodhayitum tadaa || 6-60-43

tato gurutaram yatnam daarunam samupaakraman |

As they were unable to rouse him by these means, they resorted to more energetic and ruthless methods.

ashvaanustraan kharaannaagaan jaghnardandakashaankushaih || 6-60-44

bheriishankhemridangaamshcha sarvapraanairavaadayan |

They beat horses, camels, donkeys, and elephants with sticks whips and thongs, so that they trample upon him and blasted kettle-drums, couches and drums.

nijaghnashchaasya gaatraani mahaakaasthakatamkaraih || 6-60-45

mudgarairmusalaishchaapi sarvapraanasamudyataih |

They crushed his limbs under piles of heavy logs and pillars, as also maces lifted with all their strength.

tena naadena mahaaa lankaa samabhipuuritaa || 6-60-46

saparvatavanaa sarvaa so.api naiva prabudhyate |

The entire Lanka, with its mountain and groves, was filled with great noise. He nevertheless did not wake.

tatah sahasram bheriinaam yugapatsamahanyata || 6-60-47

mristakaajnchanakonaanaa maasaktaanaam samantatah |

Then, they beat a thousand drums all around with sticks of refined gold.

evanaotatubudrasty tadaa bauva oravydgtata || 6-60-48

shaapasya vashamaapannastatah kruddhaa nishaacharaah |

Yet, as he did not wake from his profound slumber, being under the spell of a curse, the demons were enraged.

mahaakrodhasamaavistaah sarve bhiimaparaakramaah || 6-60-49

tadrakso bodhayisyantashchakruranye paraakramam |

All those demons of terrible strength were filled with a great fury. Some others assembled their strength to awaken that demon.

anye bheriih samaajaghnaranye chakrurmahaasvanam || 6-60-50

keshaananye pralulupuh karnaavanye dashanti cha |

Some beat drums, some shouted, some tore out his hair and some others bit his ears.

udakumbhashataanyanye samasijnchanta karnayoh || 6-60-51

na kumbhakarnah paspande mahaanidraavasham gatah |

Some poured hundreds of pitchers of water into his ears but Kumbhakarna, plunged in deep sleep, did not stir.

na kumbhakarnah paspande mahaanidraavasham gatah || 6-60-52

muurdhni vaksasi gaatresu paatayan kuutamudgaraan |

Some strong ones, armed with rocks and hammers, struck the rocks and hammers on his head, chest and other limbs.

rajjubandhanabaddhaabhih shatagniibhishcha sarvashah || 6-60-53

vadhyamaano mahaakaayo na praabudhyata raaksasah |

Though smitten by missiles fastened with ropes on all sides, the giant bodied demon did not wake.

vaaranaanaam sahasram cha shariire.asya pradhaavitam || 6-60-54

kumbhakarnastadaa buddhvaa sparsham paramabudhyata |

A thousand elephants ran up and down on his body till Kumbhakarna lightly woke up and became aware of the pressure.

sa paatyamaanairgirishringavriksai |

rachintayamstaanvipulaan prahaaraan |

nidraaksayaat ksudbhayapiiditashcha |

vijrimbhamaanah sahasotpapaapa || 6-60-55

Being insensible to those violent blows of crags and trees hurled upon him, but under the prompting of extreme hunger, Kumbhakarna suddenly sprang up from sleep, yawning due to loss of sleep.

sa naagabhogaachalashringakalpau |

viksipya baahuu jitavajrasaarau |

vivritya vaktram vadavaamukhaabham |

nishaacharo.asau vikritam jajrimbhe || 6-60-56

Waving his arms resembling serpent's coils or the peaks of mountains, hard as cut diamonds, that demons opening his monstrous month like unto the face of a submarine fire, yawned.

tasya jaajrimbhamaanasya vaktram paataalasamnibham |

dadrushe merushringaagre divaakara ivoditah || 6-60-57

His mouth yawning horribly resembled hell and appeared like the sun rising under the high peak of Meru Mountain.

sa jrimbhamaano.atibalah prabuddhastu nishaacharah |

nihshvaasashchaasya samjajjne parvadaadiva maarutah || 6-60-58

That mighty demon, being awake, yawned, heaving a sigh, like unto a tempest arising from a mountain.

ruupamuttisthatastasya kumbhakarnasya tad babhau |

yugaane sarvabhuutaani kaalasyeva didhaksatah || 6-60-59

That figure of Kumbhakarna, rising up, stood out resembling Time at the dissolution of the world, prepared to devour all beings.

tasyaagnidiiptisadrishe vidyutsadrishavarchasii |

dadrishaate mahaanetre diiptaaviva mahaagrahau || 6-60-60

His huge eyes, resembling flames of fire, with a glitter equal to that of lightning, appeared like great blazing planets.

tatastvadarshayan sarvaan bhaksyaamshcha vividhaan bahuun |

varaahaan mahisaamshchaiva babhaksa sa mahaabalah || 6-60-61

Then, the demons pointed to various kinds of victuals, boar and buffalo. The mighty Kumbhakarna devoured them.

aadadbubhuksito maamsam shonitam trisito.apibat |

medahkumbhaamshcha madyaamshcha papau shakraripustadaa || 6-60-62

Then, the hungry Kumbhakarna, the enemy of Indra, ate the meat and being thirsty drank the blood and gulped pitchers full of fat and wine.

tatastripta iti jjnaatvaa samutperurnishaacharaah |

shirobhishcha pranamyainam sarvatah paryavaarayan || 6-60-63

Thereupon, knowing that Kumbhakarna was gratified of his hunger, the demons approached him, saluting him with their heads bent and surrounded him on all sides.

nidraavishadanetrastu kalusiikritalochanah |

chaarayan sarvato dristim taanuvaacha nishaacharaan || 6-60-64

Raising his eyelids that were heavy with sleep, his gaze still veiled, he directed his glance towards those demons and spoke as follows:

sa sarvaan saantvayaamaasa nairrtaan nairritarsabhah |

bodhanaadvismitashchaapi raaksasaanidamabraviit || 6-60-65

That excellent demons kindly addressing all the demons and surprised at being roused, spoke the following words to the demons:

kimarthamahaamaadritya bhavadbhih pratibodhitah |

kacchitsukushalam raajjno bhayam vaa neha kimchan || 6-60-66

"For what reasons have you thus wakened me so suddenly? Is all well with the king or anything in peril here?"

athavaa dhruvamanyebhyo bhayam paramupasthitam |

yadarthameva tvarirairbhavadbhih pratibodhitah || 6-60-67

"Surely, there must be some great danger from an external source since you have wakened me in haste."

adya raaksasaraajasya bhayamutpaatayaamyaham |

daarayisye mahendram vaa shiitayisye tathaanalam || 6-60-68

"Now, I shall drive away the misfortune from Ravana the King of Demons, even if I have to cut Mahendra himself to pieces or to freeze the Fire.

sa hyalpakaarane suptam bodhayisyati maadrisham |

tadaakhyaataarthatattvena matprabodhanakaaranam || 6-60-69

"For a petty reason, one does not indeed awaken, one such as I, from my slumber. Hence, tell me frankly, for what reason you have roused me."

evam bruvaanam samrabdham kumbhakarnamarimdamam |

yuupaaksah sachivo raajjnah kritaajnjalirabhaasata || 6-60-70

Yupaksha, a minister of the King, with his hands joined salutation, spoke (as follows) to Kumbhakarna, the annihilator of his enemies, thus talking excitedly.

na no devakritam kimchidbhayamasti kadaachana |

maanusaanno bhayam raajamstumulam samprabaadhate || 6-60-71

"O, Prince! There is no threat whatsoever at anytime for us from celestials but a mere man is driving us back by a tumultuous tremor."

na daityadaanavebhyo vaa bhayamasti hi taadrisham |

yaadrisham maanusam raajan bhayamasmaanupasthitam || 6-60-72

"O, Prince! It is not indeed the celestials or demons who have put us in such a peril as it comes to us from a man."

vaanaraih parvataakaarairlankeyam parivaaritaa |

siitaaharanasamtaptaadraamaannastumulam bhayam || 6-60-73

"Monkeys, whose forms are as large as mountains, are besieging Lanka. There is a tumultuous peril for us from Rama, who is furious on account of Seetha's abduction."

ekena vaanareneyam puurvam dagdhaa mahaapurii |

kumaaro nihatashchaaksah saanuyaatrah sakujnjarah || 6-60-74

"Already, a single monkey set fire to our great city of slew the youthful Prince Aksha with his escort of elephants and retinue."

svayam raksodhipashchaapi paulastyo devakantakah |

vrajeti samyuge mukto raamenaadityavarchasaa || 6-60-75

" ' Get thee hence' were the words addressed by Rama who is equal to the sun in splendor, to Ravana in person the Lord of Demons and the trouble-some person to celestials."

yanna devaih krito raajaa naapi daityairna daanavaih |

kritah sa iha raamena vimuktah praanasamshayaat || 6-60-76

"That which this king never suffered at the hands of Gods or Demons or Danavas, he has had to endure here from Rama, who released him from the danger to his life."

sa yuupaaksavachah shrutvaa bhraaturyudhi paraabhavam |

kumbhakrno vivrittaakso yuupaaksamidamabraviit || 6-60-77

Hearing about the humiliation of his brother in the battle through the words of Yupaksha, Kumbhakarna rolling his great eyes, spoke to Yupaksha (as follows):

sarvamadyaiva yuupaaksa harisainyam salaksmanam |

raaghavam cha rane jitvaa tato draksyaami raavanam || 6-60-78

"O, Yupaksha! Now itself, after conquering the entire army of monkeys with Lakshmana and Rama on the battle-field, then only I shall see Ravana."

raaksasaamstarpayisyaami hariinaam maamsashonitaih |

raamalaksmanayoshchaapi svayam paasyaami shonitam ||6-60-79

"I shall satiate the demons with the flesh and blood of monkeys and, as for Rama and Lakshmana, I shall drink their blood myself."

tattasya vaakyam bruvato nishamya |

sagarvitam rosavivriddhadosam |

mahodaro nairritayodhamukhyah |

kritaajnjalirvaakyamidam babhaase || 6-60-80

Hearing these haughty from that demon, whose anger increased his ferocity, Mahodara the chief of warriors of demons, having offered obeisance with joined palms, spoke the following words:

raavanasya vachah shrutvaa gunadosau vimrishya cha |

pashchaadapi mahaabaaho shatruunyudhi vijesyasi || 6-60-81

"O, the mighty armed! When you have listened to the words of Ravana and considered the advantages and disadvantages of the matter, even afterwards you can conquer the enemies in battle."

mahodaravachah shrutvaa raaksasaih parivaaritah |

kumbhakarno mahaatejaah sampratasthe mahaabalah || 6-60-82

Hearing the words of Mahodara, the might Kumbhakarna of great valor prepared to depart, surrounded by demons.

suptamutthaapya bhiimaaksam bhiimaruupaparaakramam |

raaksasaastvaritaa jagmurdashagriivaniveshanam || 6-60-83

The demons, having awakened that sleeping Kumbhakarna of dreadful eyes, form and valor went to the King's palace in haste.

teabhigamya dashagriivamaasiinam paramaasane |

uuchurbaddhaajnjaliputaah sarva eva nishaacharaah || 6-60-84

All those demons, approaching Ravana who was seated on the throne, said to him with joined palms, as follows:

kumbhakarnah prabuddho.asau bhraataa te raaksaseshvara |

katham tatraiva niryaatu draksyase tamihaagatam || 6-60-85

"O, Lord of Demons! Kumbhakarna, your brother, has wakened. Is it your will that he should enter the battle field from there itself or do you desire him to come here and see you?"

raavanastvabraviiddhristo raaksasaamstaanupasthitaan |

drastumenamihechchhaami yathaanyaayam cha puujyataam || 6-60-86

Ravana answered those demons who stood before him and with a glad heart, said: "I want to see him here. Bring him after extending the honors due to him in a befitting manner."

tathetyuktvaa tu te sarve punaraagamya raaksasaah |

kumbhakarnamidam vaakyamuuchuu raavanachoditaah || 6-60-87

Uttering "Be it so", all those demons as commanded by Ravana, returned to Kumbhakarna and spoke the following words:

drastum tvaam kaamksate raajaa sarvaraaksasapumgavah |

gamane kriyataam buddhirbhraataram sampraharsaya || 6-60-88

"The king, the lion of all the demons, desires to see you. Go and gratify your brother!"

kumbhakarnastu durdharso bhraaturaajjnaaya shaasanam |

tathetyuktvaa mahaaviiryah shayanaadutpapaata ha || 6-60-89

Hearing his brother's wish, Kumbhakarna the inviolable demon of great prowess, uttering "so be it", leapt up from his couch.

praksaalya vadanam hrstah snaatah paramabhuusitah |

pipaasustvarayaamaasa paanam balasamiiranam || 6-60-90

Washing his face and bathing, refreshed and delighted, adorning himself well and feeling thirsty, he hastened them to bring him a drink which can boost up his strength.

tataste tvaritaastatra raaksasaa raavanaajjnayaa |

madyam bhaksyaamshcha vividhaan ksipramevopahaarayan || 6-60-91

Thereupon, those demons brought him quickly the wine and various kinds of eatable there, in their hurry to take Kumbhakarna with them as per Ravana's commands.

piitvaa ghatasahasre dve gamanaayopachakrame |

iisatsamutkato mattastejobalasamanvitah || 6-60-92

Having drunk two thousand pitchers, Kumbhakarna prepared to set out and slightly inebriated and flushed, he was exhilarated and filled with energy.

kumbhakarno babau rustah kaalaantakayamopamah |

bhruutuh sa bhavanam gachchhan raksobalasamanvitah || 6-60-93

kumbhakarnah padanyaasairakampayata mediniim |

The fuming Kumbhakarna, going to his brother's palace along with the army of demons, appeared like Yama the Lord of Death at the end of all-destroying Time. He caused the earth to tremble with his foot-steps, while marching.

sa raajamaargam vapusaa prakaashayan |

sahasrarasmirdharaniimivaamshubhih |

jagaama tatraajnjalimaalayaa vritah |

shatakraturgehamiva svayambhuvah || 6-60-94

The royal high way was illumined by his body, like unto that orb of a thousand rays (the sun) by its flashes illumines the earth and he went there, surrounded by a circle of demons paying obeisance, resembling Indra the Lord of Celestials approaching the abode of Brahma the Lord of Creation.

tam raajamaargasthamamitraghaatinam |

vanaukasaste sahasaa bahihsthitaah |

dristvaa.a prameyam girishringakalpam |

vitatrasuste saha yuuthapaalaih || 6-60-95

Seeing that slayer of his foes on the royal high way, that monster as high as the peak of a mountain, those monkeys stationed outside the city, as also their leaders, were frightened suddenly.

kechichharanyam sharanam sma raamam |

vrajanti kechidvyathitaah patanti |

kechiddishashcha vyathitaah patanti |

kechidbayaartaabhuvi sherate sma || 6-60-96

Some gained refuge in Rama who affords protection, some fell down tottering, some fled away perturbed in all directions and some others lay on the ground, confounded with fear.

tamadrishringapratimam kiriitinam |

sprishantamaadityamivaatmatejasaa |

vanaukasah preksya vivriddhamadbhutam |

bhayaarditaa dudruvire yatastatah || 6-60-97

Seeing that colossus appearing like a great peak, having a diadem who seemed to touch the sun with his brilliance, the monkeys were seized with terror and had grown immensely in size, fled hither and thither.

ityaarse shriimadraamaayane aadikaavye yuddhakaamde sastitamah sargah

Thus completes 60th Chapter of Yuddha Kanda of the glorious Ramayana of Valmiki, the work of a sage and the oldest epic.

Sriman Moola Rama Vijayate

References

K. M. K. Murthy. (2002). Yuddha Kanda - Book Of War.

Merriam-Webster. (2007). At http://www.m-w.com.

Reference.com. (2007). At http://www.reference.com.

About YouSigma Please Donate Using PayPal, to help us Develop Content
Copyright and Disclaimer Iridium rentals
Loading
underline
underline
Try a free sample Destiny Reading! Executive Openings! $80,000 to $500,000+
var pageName = "Chapter 60: Rakshasas Wake Kumbhakarna";