YouSigma- the web's most extensive resource for information
$6.99 Domain Names at Network Solutions®!
Chapter 10: Vibhishana Pleads with Ravana

Go to Home Page

Tell Your Friend About This Website

Download PDF Version

Play Yuddha Kanda Chapter 10 Audio

Vibhishana Pleads with Ravana

Summary

Vibhishana, the half-brother of Ravana, lists out bad omens occurring in the city and in the gynaeceum and advises Ravana to restore Seetha to Rama as an atonement t these evil forces. Ravana turns a deaf ear to Vibhishana’s counsel and sends him away.

Chapter [Sarga] 10 in Detail

tatah pratyusasi praapte praaptadharmaarthanishchayah |

raaksasaadhipaterveshma bhiimakarmaa vibhiisanah || 6-10-1

Vibhishana, who always arrived at a settlement in matters of virtue, pleasure and wealth and who was terrible in his act, on arrival of the dawn, entered the palace of Ravana.

shailaagracayasamkaasham shailashrij~gamivonnatam |

suvibhaktamahaakaksam mahaajanaparigraham || 6-10-2

Ravana’s palace was looking like a mass of rocks, elevated like a mountain-peak, well-divided into spacious apartments and occupied by eminent men.

matimadbhirmahaamaatrairanurakairadhisthitam |

raaksasairaaptaparyaaptaih sarvatah pariraksitam || 6-10-3

It was inhabited by prime ministers, who were intelligent and beloved. It was guarded on all sides by demons, who were trust worthy and efficient.

mattamaatajganihshvaasairvyaakuliikritamaarutam |

shajkhaghosamahaaghosam tuuryasambaadhanaaditam || 6-10-4

The air was filled with the sighing breaths of elephants in rut, with tumultuous noise produced by the blowing of conches and made to resound by an ensemble of musical instruments.

pramadaajanasambaadham prajalpitamahaapatham |

taptakaajncananiryuuham bhuusanottamabhuusitam || 6-10-5

The palace was filled with a number of women-folk. It was having principal passages in which spoken words were heard. It was having turrets made of pure gold and adorned with excellent decors.

gandharvaanaamivaavaasamaalayam marutaamiva |

ratnasamcayasambaadham bhavanam bhoginaamiva || 6-10-6

The palace was like an abode of Gandharvas (celestial musicians) and of Maruts (storm-gods) filled with a collection of jewels resembling a house of Nagas (serpent-gods).

tam mahaabhramivaaditya stejovistritarashmimaan |

agrajasyaalayam viirah pravivesha mahaadyutih || 6-10-7

The valiant Vibhishana with great splendor entered that mansion of his elder brother, Ravana, like the sun with rays outstretched with splendor entering a big cloud.

punyaan punyaahaghosaamshcha vedividbhirudaahritaan |

shushraava sumahaatejaa bhraaturvijayasamshritaan || 6-10-8

Vibhishana with great radiance, heard the auspicious sounds of felicitous recital of prayers uttered by the knowers of Vedas (scriptural texts), wishing for the victory of his brother.

puujitaan dadhipaatraishca sarpirbhih sumanoksataih |

mantravedavido vipraan dadarsha sa mahaabalah || 6-10-9

Vibhishana of great strength saw Brahmins who know Mantras (sacred texts) and Brahmanas, respected and offered with pots filled of curd, clarified butter as well as with flowers and unbroken rice.

sa puujyamaano raksobhiddiipyamaanam svatejasaa |

asavastham mahaabaahurvavande dhanadaanujam || 6-10-10

The mighty armed Vibhishana, being adored by the demons and shining by his own splendor, offered salutation to Ravana the younger brother of Kubera (the lord of riches), who occupied the throne.

sa raajadristisampannamaasanam hemabhuusitam |

jagaama samudaacaaram prayujyaacaarakovidah || 6-10-11

Practicing customary formalities, Vibhishana who knew the code of conduct, obtained a seat adorned with gold, as endowed to him by a glance of the king.

sa raavanam mahaatmaanam vijane mantrisamnidhau |

uvaaca hitamatyartham vacanam hetunishchitam || 6-10-12

In the presence of ministers and in privation, Vibhishana spoke to powerful Ravana the words convinced of reason and which were very much beneficial.

prasaadya bhraataram jyestham saantvenopasthitakramah |

deshakaalaarthasamvaadi dristalokaparaavah || 6-10-13

Vibhishana, who could discriminate between good and evil things in the world, having sought the favor from his eldest (half-) brother by means of soothing words arranged in an order, spoke in consonance with place, time and purpose.

yadaa prabhriti vaidehii sampraapteha paratapa |

tadaa prabhriti drishyante nimittaanyashubhaani nah || 6-10-14

 “O, annihilator of enemies! We are seeing inauspicious omens, since Seetha arrived here.”

sasphulijgah sadhuumaarcih sadhuumakalusodayah |

mantrasamghahuto.apyagnirna samyagabhivardhate || 6-10-15

 “Even if the sacrificial fire is fed with oblations while uttering a proper set of Mantras (Spiritual texts), the fire is not flaring up well, emitting sparks, its flames are enveloped in smoke and are coming forth, polluted with soot.”

agnisthesvagnishaalaasu tathaa brahmasthaliisu ca |

pariipripaani drishyante havyesu ca pipiilikaah || 6-10-16

 “Serpents are seen at the corner of the sacrificial post which is nearest the fire, also in houses keeping sacrificial fire and in places where sacred studies are made. Ants are seen in things to be offered as oblations.”

gavaam payaamsi skannaani vimadaa varakujnjaraah |

diinamashvaah prahesante na ca graasaabhinandinah || 6-10-17

 “Cow’s milk is getting curdled. Excellent elephants are bereft of rut. Horses are neighing miserably and are not rejoiced in eating grass.”

kharostraashvataraa raajanbhinnromaah sravanti ca |

na svabhaave.avatisthante vidhaanairapi cintataah || 6-10-18

 “O, king! Donkeys, camels and mules shed tears, losing their hair and even if treated as per medical procedures are not getting cured.”

vaayasaah saghashah kruuraa vyaaharanti samantatah |

samavetaashca drishyante vimaanaagresu samghashah || 6-10-19

 “Crows in flocks are crying cruelly from all sides and are seen in crowds assembled together on house-tops.”

gridhraashca pariliiyante puriimupari pinditaah |

upapannaashca samdhye dve vyaaharantyashivam shivaah || 6-10-20

 “Vultures fly to and fro in circles over the city. Jackals are crying inauspiciously at the approach of both dawn and the dusk.”

kravyaadaanaam mrigaanaam ca puriidvaaresu saj~ghashah |

shruuyante vipulaa ghosaah savisphuurjitanihsvanaah || 6-10-21

 “At city-gates are heard loud cries of carnivorous animals gathered in groups, with thundering noise.”

tadevam prastute kaarte praayashcittamidam ksamam |

rocaye viira vaidehii raaghavaaya pradiiyataam || 6-10-22

 “O, brave man! Hence, when the actions of evil forces are happening in this way, this atonement is appropriate that Seetha be given away to Rama and I like it.”

idam ca yadi vaamohaallobhaadvaa vyaahritam mayaa |

tatraap ca mahaaraaja na dosam kartumarhasi || 6-10-23

 “O, emperor! If I am speaking this because of infatuation or greed, in that case also, you ought not to find fault with me.”

ayam hi dosah sarvasya janasyaapyopalaksyate |

raksasaam raaksasiinaam ca purasyaantah purasya ca || 6-10-24

 “These bad omens are being seen indeed by demons and lady-demons of the city and of the gynaeceum as well as all these people here.”

praapane caasya mantrasya nivrittaah sarvamantrinah |

avashyam ca mayaa vaacyam yaddristamathavaa shrutam || 6-10-25

samvidhaaya yathaanyaayam tadbhavaan kartumarhati |

 “All your ministers have abstained to pass this counsel to you. Whatever is seen or heard, it is to be told certainly by me. Hence, you ought to do according to a justification of things for the occasion.”

iti svamantrinaam madhye bhraataa bhraataramuucivaan || 6-10-26

raavanam raksasaam shrestham pathyametadvibhiisanah |

Vibhishana, the half- bother spoke these beneficial words to Ravana, the best among demons in the midst of his half-brother’s ministers.

hitam mahaartham maridu hetusamhitam |

vyatiitakaalaayatisampratiksamam |

nishamya tadvaakyamupasthitajvarah |

prasaj~gavaanuttarameta dabraviit || 6-10-27

Ravana, who had evil inclination, heard those words, which were beneficial very well-meant, soft, conformable to reason and suitable for the past future and present times, got enraged and uttered this reply.

bhayam na pashyaami kutashcidapyaham |

na raaghavah praapsyati jaatu maithiliim |

suraih sahendrairapi samgare katham |

mamaagratah sthaasyati laksmanaagrajah || 6-10-28

 “I do not see any fear from whom so ever. Rama cannot obtain Seetha by any means. How Rama even along with Indra and the celestials can stand before me in battle?”

ityevamukrvaa surasainyanaashano |

mahaabalah samyati candavikramah |

dashaanano bhraataramaaptavaadinam |

visarjayaamaasa tadaa vibhiisanam || 6-10-29

Ravana, who annihilated the army of celestials and who was very powerful with an impetuous valor, thus spoke and then sent away Vibhishana, who had spoken honestly.

ityaarse shriimadraamaayane aadikaavye yuddhakaande dashamah sargah

Thus completes 10th Chapter of Yuddha Kanda of the glorious Ramayana of Valmiki, the work of a sage and the oldest epic.

Sriman Moola Rama Vijayate

References

K. M. K. Murthy. (2002). Yuddha Kanda - Book Of War.

Merriam-Webster. (2007). At http://www.m-w.com.

Reference.com. (2007). At http://www.reference.com.

About YouSigma Please Donate Using PayPal, to help us Develop Content
Copyright and Disclaimer Iridium rentals
Loading
underline
underline
Try a free sample Destiny Reading! Executive Openings! $80,000 to $500,000+
var pageName = "Chapter 10: Vibhishana Pleads with Ravana";